Basic Information | |
---|---|
IMG/M Taxon OID | 3300025190 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054020 | Ga0208472 |
Sample Name | Marine microbial communities from the Deep Atlantic Ocean - MP0326 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 45328359 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | East of Recife, Brazil, South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -9.12 | Long. (o) | -30.19 | Alt. (m) | N/A | Depth (m) | 4001.48 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013190 | Metagenome / Metatranscriptome | 273 | Y |
F105349 | Metagenome / Metatranscriptome | 100 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208472_117137 | Not Available | 639 | Open in IMG/M |
Ga0208472_122815 | Not Available | 528 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208472_117137 | Ga0208472_1171371 | F105349 | YEYKFVTQDLKWNLEFLSKNDVQLNCAFQNWAHLPKEGYDQIIYLDNDIFIFEDTGSPPIVDFGLVCRLGDQIQYAKYYCGNNSLWWNSGVMLMSQKRCKHLSSWMLDYIPRAREFPIFRDLPREESLITEYCKKYKPTKLDPIWNTMPPQTPIPMYSDAKIIHLLGASKLNTLLKCPKEIQKIIMKNIVVSEKITA |
Ga0208472_122815 | Ga0208472_1228152 | F013190 | TCDGSIPLNEMPSTVASKVASSTKVDIAEIIAFHSLEVFVLAENSNLIK |
⦗Top⦘ |