NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025190

3300025190: Marine microbial communities from the Deep Atlantic Ocean - MP0326 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025190 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054020 | Ga0208472
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP0326 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size45328359
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEast of Recife, Brazil, South Atlantic Ocean
CoordinatesLat. (o)-9.12Long. (o)-30.19Alt. (m)N/ADepth (m)4001.48
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013190Metagenome / Metatranscriptome273Y
F105349Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208472_117137Not Available639Open in IMG/M
Ga0208472_122815Not Available528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208472_117137Ga0208472_1171371F105349YEYKFVTQDLKWNLEFLSKNDVQLNCAFQNWAHLPKEGYDQIIYLDNDIFIFEDTGSPPIVDFGLVCRLGDQIQYAKYYCGNNSLWWNSGVMLMSQKRCKHLSSWMLDYIPRAREFPIFRDLPREESLITEYCKKYKPTKLDPIWNTMPPQTPIPMYSDAKIIHLLGASKLNTLLKCPKEIQKIIMKNIVVSEKITA
Ga0208472_122815Ga0208472_1228152F013190TCDGSIPLNEMPSTVASKVASSTKVDIAEIIAFHSLEVFVLAENSNLIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.