3300025100: Hot spring sediment microbial communities from Zodletone spring, Oklahoma to study Microbial Dark Matter (Phase II) - Zodletone Spring source 0.5m metaG (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300025100
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111485 | Gp0138765 | Ga0209205
• Sample Name: Hot spring sediment microbial communities from Zodletone spring, Oklahoma to study Microbial Dark Matter (Phase II) - Zodletone Spring source 0.5m metaG (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 244425745
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: USA: Oklahoma, Zodletone Spring
• Coordinates
  • Lat. (^o): 34.9956
  • Long. (^o): -98.6889
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025653	Metagenome / Metatranscriptome	200	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209205_1071429	All Organisms → cellular organisms → Archaea	583

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209205_1071429	Ga0209205_10714292	F025653	PMKYFESKLKTMCLAELKDYRKRLDESIKQKIDQTAPNEQIAPLILYRGIVEHEMTTRMNKMKNQ