Basic Information | |
---|---|
IMG/M Taxon OID | 3300025089 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111485 | Gp0127790 | Ga0209394 |
Sample Name | Hot spring microbial communities from Jinze hot spring, China to study Microbial Dark Matter (Phase II) - JNZ 20120812A (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 167229564 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2 |
All Organisms → cellular organisms → Archaea | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | aquatic biome → hot spring → sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Baoshan, Yunnan, China | |||||||
Coordinates | Lat. (o) | 25.4413 | Long. (o) | 98.46 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051554 | Metagenome | 144 | Y |
F064214 | Metagenome | 129 | Y |
F091320 | Metagenome | 107 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209394_1030973 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 969 | Open in IMG/M |
Ga0209394_1041642 | All Organisms → cellular organisms → Archaea | 702 | Open in IMG/M |
Ga0209394_1044113 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 657 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209394_1030973 | Ga0209394_10309733 | F064214 | SEKGDLKVLAKSAEDLAYALRDTLDVLADHERRIKRLEEKLGFLADVESRVVEKAVAGGHVE |
Ga0209394_1041642 | Ga0209394_10416422 | F091320 | DPHGTLASRLKPNPLLEINFTKGKVDISNNLERIYEEASNWPETNELRLLIVLDETRLLKAKNLVYCVNELGKRGVGFLLITQYSTSIPPEIRNVGTYFIMSAMSETEIQRFKEITLHPSSKLITRLPKAVSYVFSPYWYPEPFFIKNRKVGR |
Ga0209394_1044113 | Ga0209394_10441131 | F051554 | EGSAEYSLKEKLINIEGVAIDTSVNKNKWQVPREDLQHIVESLKGAQLRVDHAESALMVVGKVVDAWIDGERVLFRAEVGEEKLIEKILRGYVSHVSIQVDSDEVECSKCKRQTRRDGMLIHLCPGAWEIVHKPRVRELSIVASPAYDNTEFKPLGFYAAMNDAQWNAIVETFTKAGLLETSKSSQSSPNVDGDVGSKAESLQEPEQKPVLKTPQNEV |
⦗Top⦘ |