3300025067: Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_130316 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300025067
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111485 | Gp0127783 | Ga0209393
• Sample Name: Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_130316 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 137159849
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: USA: Nevada, Gerlach, Sandy's Spring West
• Coordinates
  • Lat. (^o): 40.653
  • Long. (^o): -119.3749
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063403	Metagenome / Metatranscriptome	129	N
F084856	Metagenome / Metatranscriptome	112	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209393_1018237	Not Available	1381
Ga0209393_1020285	Not Available	1266

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209393_1018237	Ga0209393_10182372	F063403	MEGNINRTEALRELRAAIRSVRRTPIKIPFGNSDKFFIEIRIPKFSERLDIQMAAELFLGGFDSSERLVKALPPLITSFRLPAEDEEGNLMQAIYNAEPLPDLPVLQLEPSDLFSDESAFNATPVLMTLIITTLLTLSGRTQNVAAGMNELLELFPGTNQNATDLLDKGSSRVSGSE
Ga0209393_1020285	Ga0209393_10202852	F084856	SESGDAMSGTFNLTIVTHIYTSQHAEALKETLPEWVRLSPSQILVGYYQKKFQPSDFQCMETYDGVELVPVDSSSYGAAYDVLLERVVGKPILILAPYVIPKDWFVGSVSKWFESYAIIGHYKQPRILVADAILMPLIAPVVVELGRLQMDCIAVREDVPRSVGYHEWWFGSILVRARPGAFLLYNALAAGYPVLTLPYNCKPVRYVRNPERQPSKAHKK