NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025056

3300025056: Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 3A3 metaG (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025056 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111485 | Gp0154760 | Ga0209315
Sample NameFreshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 3A3 metaG (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size15559117
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomebayoufresh water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090615Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209315_100936All Organisms → cellular organisms → Bacteria → Proteobacteria2266Open in IMG/M
Ga0209315_101708Not Available1280Open in IMG/M
Ga0209315_103881Not Available619Open in IMG/M
Ga0209315_104785Not Available533Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209315_100936Ga0209315_1009364F090615TDPSLIAALRVRKGWLRPDSSIVDKAAAEGLKKLGVLLCPPPDPDGKSIPERRFIDIATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHGNLVTAIKIANGERLRAAKAKPAAGS
Ga0209315_101708Ga0209315_1017083F090615MRALQLAAPEPTDPSLIAALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDPDGKSIPERRFIDIATEYLKAVPQARLLIEESAVEHQASWDPDKVYVERTDADIHEEMVTAIKIANGERLRAARAKASAGS
Ga0209315_103881Ga0209315_1038812F090615SLIAALRVRKGWLRPDSPIVDKAAAEGLKKLGALLCPPPDADKRSATVKQINEVATEYLKAVPQTRLLIEESAVEHQASWDPDKVYVERTDADIHENLVTAIKIANAERLRAAEAKAAAG
Ga0209315_104785Ga0209315_1047851F090615RKGWLRPDSSIVDKAAVEGLKKLGVLLCPPPDPEGKSIPAKLFNEIAAEYLKTVPQTRLLIEESAVEHQAFWDADQPYIDQSDEDIHEEMVTAIKMANADRLRAARAKASAGS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.