3300024932: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 73_LOW10 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300024932
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114290 | Gp0111113 | Ga0208756
• Sample Name: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 73_LOW10 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 71464601
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: USA: Lake Washington, Seattle, Washington
• Coordinates
  • Lat. (^o): 48.3807
  • Long. (^o): -122.1599
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020726	Metagenome / Metatranscriptome	222	Y
F054971	Metagenome / Metatranscriptome	139	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208756_102774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	3442
Ga0208756_105001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1976

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208756_102774	Ga0208756_1027745	F054971	GRFPPWTIVVYAVSIVVIVGLWLNVAGIPFPPSVGPYAVALTWAICVFGFIFVRTIELFLHREV
Ga0208756_105001	Ga0208756_1050012	F020726	VTPAESGYVLQLASLSLSFVGFSALVVTLRGALGGDLSDRHLRLVRLYIEGGLLVTALALVPTLLNLLHIPDTVTWALSSAATALIFSFVLLIQFRRRRTV