3300024309: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B20A

Overview

Basic Information

• IMG/M Taxon OID: 3300024309
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121620 | Gp0224303 | Ga0222427
• Sample Name: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B20A
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 171320524
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
• Type: Host-Associated
• Taxonomy: Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.0758
  • Long. (^o): -89.4125
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027578	Metagenome / Metatranscriptome	194	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0222427_128951	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	561

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0222427_128951	Ga0222427_1289511	F027578	MDRRSLFGLTAAAGGLLAARTVLPANAQATGPAHHGEPKLEPQPKIPQQQQFRIGYTTNTRGGWESDVFLGISEGREIGFRYFEIFGASFCATPNGMNAPPRDKQAMKTWPDG