3300024308: Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-FT3-sol

Overview

Basic Information

• IMG/M Taxon OID: 3300024308
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118431 | Gp0290895 | Ga0247725
• Sample Name: Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-FT3-sol
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 200826213
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → gas well → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Oklahoma
• Coordinates
  • Lat. (^o): 35.7
  • Long. (^o): -98.594
  • Alt. (m): N/A
  • Depth (m): 3933

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009686	Metagenome / Metatranscriptome	314	Y
F081964	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0247725_1018865	Not Available	1656

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0247725_1001519	Ga0247725_100151917	F081964	MSMAKVHYRHLIVRAVTGGRPALVFSVTDGAALDRICERLVEAERAAEILQSLGYGKPGLLLHEVAALVPPAP
Ga0247725_1018865	Ga0247725_10188652	F009686	MTEKEMYEASFQRPKNFFKLSESEQFEIDKKLGILDWSGVGLTKEEIARFKEHYKQ