NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023712

3300023712: Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Bagasse, Gen0, Rep 2 Spades (v2)



Overview

Basic Information
IMG/M Taxon OID3300023712 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118397 | Gp0213380 | Ga0257067
Sample NameGoat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Bagasse, Gen0, Rep 2 Spades (v2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size391104836
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium F0831

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDetermining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)34.4148Long. (o)-119.8405Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041521Metagenome159Y
F081939Metagenome / Metatranscriptome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0257067_1068930Not Available576Open in IMG/M
Ga0257067_1079089Not Available530Open in IMG/M
Ga0257067_1082166All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium F083519Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0257067_1068930Ga0257067_10689302F041521FSNTGAKTTLENCLFAGKFERGANLTDEARLGAFGTLRSVNAIKNCYYLAHDGLEAVHSDSDLDTNSDNVEITPVTEEELRGDTIVTKLGECWTRGENYPVIKK
Ga0257067_1079089Ga0257067_10790891F041521FSNTGAKTTLENCLFAGKFERGANLTDEAELTAFGTLRSVNAIKKCYYLADDDLEAVHSNSDLKPGSDNVEIEGVTEDDLRNNTIATQLGEYWTQGENYPVIKK
Ga0257067_1082166Ga0257067_10821661F081939LTKREKVGMLADKLNEAINSCKLEPTEELDIFAESVALLIAYWGKISDWSPIEKASYVGYVTTTIMEKGLDAEIKSFEEHRKSMKPQIGN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.