3300023507: Marine microbial mat from Loihi Seamout, Hawaii, USA - Marker 31 Individual Assembly

Overview

Basic Information

• IMG/M Taxon OID: 3300023507
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118692 | Gp0139191 | Ga0257019
• Sample Name: Marine microbial mat from Loihi Seamout, Hawaii, USA - Marker 31 Individual Assembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Western Washington University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 259766108
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Mats From Loihi Seamount, Hawaii, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Loihi Seamount, Hawaii, USA
• Coordinates
  • Lat. (^o): 18.902
  • Long. (^o): -155.257
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039145	Metagenome / Metatranscriptome	164	Y
F059103	Metagenome / Metatranscriptome	134	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0257019_1006466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium	5769
Ga0257019_1067062	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1055

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0257019_1006466	Ga0257019_10064663	F039145	MRGFLTSLLVSMVLLAGCGQQPVNAPAELGAFIDELKENGVDGTLLVRPPFNADMEYVAEYEIARYASTRVVSLFKFVDSEKAQVNLQEALKNDKLSGQARNGAFVMAVTFYPPDDGAVEKIKALFLAHKFE
Ga0257019_1067062	Ga0257019_10670622	F059103	MSSSEGCDFVLRLGPLDAATAAWSLDFCGHLQQGIWRAYGDEIEAHWAATEPDQPIYGPLSPTPPSKKR