3300023307: Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-SC8

Overview

Basic Information

• IMG/M Taxon OID: 3300023307
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133538 | Gp0295818 | Ga0256749
• Sample Name: Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-SC8
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Delaware
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20042752
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrothermal Fe-Rich Mat Reference Genomes
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: International: Urashima Vent Field, Mariana Arc
• Coordinates
  • Lat. (^o): 12.92235
  • Long. (^o): 143.64928
  • Alt. (m): N/A
  • Depth (m): 2927.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256749_107031	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	845

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256749_107031	Ga0256749_1070312	F015419	MKYKITITDENGKEQSYNASRSSSDEPKNLNDFIFECLSISEDKRNLPLIAQCPNGLEVFPSIKIKFENYGSPLLGNELEAMMITWRD