| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023181 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290985 | Ga0247815 |
| Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L194-509B-1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 760514773 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003605 | Metagenome / Metatranscriptome | 477 | Y |
| F056350 | Metagenome / Metatranscriptome | 137 | Y |
| F103302 | Metagenome / Metatranscriptome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247815_10162945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 857 | Open in IMG/M |
| Ga0247815_10307195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 561 | Open in IMG/M |
| Ga0247815_10325606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247815_10162945 | Ga0247815_101629452 | F003605 | MAVGDDAIAAGYPLVPNTGEEGRVRWGAREINRTRDLIAGVLSTIPVGKAGYRTAAGITSGTLDPVNTDGQDGDIYIKTIG |
| Ga0247815_10307195 | Ga0247815_103071952 | F056350 | LAXYQRNYFNLSIGNLIKYFSILTVAFHDVHSLFGFFILLVVFSQLISGTMLSFSLVPESMLVPIVRDEEDLEDLYTDDFFXLHERGVDLLFIFSXTHLFRKLYINAFEYEHEIAXKSGVFTFMILQVVTFFGLVLCC |
| Ga0247815_10325606 | Ga0247815_103256062 | F103302 | MATQEYAASIQGVAIRVTRLDATGNLLNGPGDSYTTSAFMRVSFTPEYEEGDEITEK |
| ⦗Top⦘ |