| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023171 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290983 | Ga0247813 |
| Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409C-1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 786445810 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034190 | Metagenome / Metatranscriptome | 175 | Y |
| F034611 | Metagenome / Metatranscriptome | 174 | Y |
| F092148 | Metagenome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247813_10034686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. | 2251 | Open in IMG/M |
| Ga0247813_10111767 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1089 | Open in IMG/M |
| Ga0247813_10170682 | Not Available | 842 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247813_10034686 | Ga0247813_100346862 | F034611 | MLQSKTVLSLTIDLLANNAFNHLKDEEISALHYLILKLQEPLTSIQQNLLLTFWNHAYTGDLPAALLYRCNTVLQQLGRSPLEELVMDMDMY |
| Ga0247813_10111767 | Ga0247813_101117672 | F092148 | MIIKKKREDLSGKIKTALDKGIQKLIAETKATNSYIVVSDKNGKVKKIPAKDL |
| Ga0247813_10170682 | Ga0247813_101706821 | F034190 | SHNNFTGTSRYRTRADKHSLHPDQCPLLSILPERIVPTPLHLFLGIGNRIILDAFSELLGNERVQEALKPITTIHSAGCGGKSDLHDLNGPEISKLVRQLDPEKGKSPLKVAASSSLPAATQATHSILTRWLENLHDHLLHKGEWTTKQLVDWRAAVDDIQQHWQSEAHSKPFPKLHMLRHSVEFAERHRFLGRASEAQIESFHASFNALFHKQHRNQSGNTAERLRRSLADAALRAVQPFLQQ |
| ⦗Top⦘ |