3300023044: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E4

Overview

Basic Information

• IMG/M Taxon OID: 3300023044
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116274 | Gp0272181 | Ga0233378
• Sample Name: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E4
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 102460423
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 38.04
  • Long. (^o): -122.5
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029589	Metagenome / Metatranscriptome	188	Y
F042737	Metagenome / Metatranscriptome	157	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0233378_1021523	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	787
Ga0233378_1045639	Not Available	535

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0233378_1021523	Ga0233378_10215232	F029589	MKEYEIVAKFLNGCAGAAHPQTFFEEAELASTDDYVRAKHGKDFEKFVREELDDGRILYTYNNGTVCYIYEFTEL
Ga0233378_1045639	Ga0233378_10456392	F042737	MKLTEKSMEVYNYIKENGGRVSIEELAAGLNRTPRSVNANVTDLCSEKKGLAMREKVKGEGEDAKDITYV