| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023040 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116274 | Gp0272187 | Ga0233384 |
| Sample Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung G2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 85933037 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058575 | Metagenome / Metatranscriptome | 134 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0233384_1014295 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 881 | Open in IMG/M |
| Ga0233384_1036394 | Not Available | 549 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0233384_1014295 | Ga0233384_10142952 | F058575 | MTAQELLNQAEALRRNNRFGEAINIYREAASAPDATDDIRRKALASVELIQEINGFVNVDLLNP |
| Ga0233384_1036394 | Ga0233384_10363941 | F058575 | MEGNAKELLERAEELRRNNRFGDAINYYKAAAEAPDATDEIVRKSLASAELMQEINSFVNVDLMNP |
| ⦗Top⦘ |