NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023032

3300023032: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C0



Overview

Basic Information
IMG/M Taxon OID3300023032 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116274 | Gp0272164 | Ga0233361
Sample NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C0
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size68589688
Sequencing Scaffolds1
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058575Metagenome / Metatranscriptome134Y
F072921Metagenome / Metatranscriptome120Y
F104182Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0233361_1009645Not Available882Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0233361_1008521Ga0233361_10085212F058575MGYTAEQLFQMAQESRRNRRFGDAINLFRAASAAPDATEDIRRTCLASIDLIQEINGFVNTDLMNP
Ga0233361_1009645Ga0233361_10096452F072921CPDSLYLAIDSGCTQYSIAVSDSGVTRIPIPRSNGKMTVKLIGVISGKKVTECIDVRVKATKKAGTKAPLSSRMKMFGEKMQAKWYVFRANMKYWWLSQKKWQKALWIALLALWLGLLFSSIGRKPEVKVSSDKIQTAYIFS
Ga0233361_1030423Ga0233361_10304232F104182MMYYLTELQTRPDGVVNSTITARSSLATGLAFFYQRAAVAVTTTDFPAVALTLQDQYGTIIKNELFDTQYEAGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.