3300022879: Enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0906-MG

Overview

Basic Information

• IMG/M Taxon OID: 3300022879
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114432 | Gp0238648 | Ga0213824
• Sample Name: Enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0906-MG
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 211836763
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043551	Metagenome	156	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0213824_1080619	Not Available	541

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0213824_1080619	Ga0213824_10806191	F043551	MTYELEEPFFEEKGKITAQKEIGVNKTQMTFSSNGTFKGNIEVTNSGDLVSLSK