3300020589: Leaf-associated microbial communities from Abies magnifica in Yosemite National Park, California, United States - Redfir_Yose_1

Overview

Basic Information

• IMG/M Taxon OID: 3300020589
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116272 | Gp0236371 | Ga0213499
• Sample Name: Leaf-associated microbial communities from Abies magnifica in Yosemite National Park, California, United States - Redfir_Yose_1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 468575290
• Sequencing Scaffolds: 20
• Novel Protein Genes: 20
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	15
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea	1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter johnsonii	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 37.6622
  • Long. (^o): -119.6197
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011735	Metagenome / Metatranscriptome	287	Y
F034461	Metagenome / Metatranscriptome	174	Y
F078199	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0213499_10003669	Not Available	1633
Ga0213499_10010519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea	1104
Ga0213499_10020366	Not Available	886
Ga0213499_10028513	Not Available	796
Ga0213499_10041970	Not Available	707
Ga0213499_10053214	Not Available	658
Ga0213499_10056194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	647
Ga0213499_10056758	Not Available	645
Ga0213499_10062464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter johnsonii	627
Ga0213499_10082061	Not Available	578
Ga0213499_10086994	Not Available	568
Ga0213499_10094820	Not Available	554
Ga0213499_10095172	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	553
Ga0213499_10097214	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus	549
Ga0213499_10099292	Not Available	546
Ga0213499_10100166	Not Available	545
Ga0213499_10103329	Not Available	540
Ga0213499_10107806	Not Available	533
Ga0213499_10112377	Not Available	526
Ga0213499_10118340	Not Available	519

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0213499_10003669	Ga0213499_100036693	F011735	HGPYVVSKVLEKGAYELVDYDGIPLGEPRNGLYLKRYYA
Ga0213499_10010519	Ga0213499_100105192	F011735	MWHGPYIDNRVLEKGAYELFDYDGIPLGEPHNGIYLKKYYA
Ga0213499_10020366	Ga0213499_100203662	F011735	LGPYIVKRVLGKGAYELVDYEGNILPRPRNGLYLKKYFA
Ga0213499_10028513	Ga0213499_100285131	F011735	MWHGPYIVDKVLEKGAYELVNYDGTSLGEPHNGLYLKQYYA
Ga0213499_10041970	Ga0213499_100419702	F011735	MWLGPYVVKRLLQKGVYELVDFEGIHMVEPWNGLYLKRYYA
Ga0213499_10053214	Ga0213499_100532141	F011735	YIVSRVFKKGAYELTDYEGNKLDEPRNGLYLKKYYA
Ga0213499_10056194	Ga0213499_100561942	F011735	MWIGPYIVFKVLKKGAYELTDYEGNKLAEPRNGLYLKKYYA
Ga0213499_10056758	Ga0213499_100567582	F011735	LGEGKFQCLWLGPYIIKRALQKGAYNLVDFEGIPLVETINGLYLKKYYA
Ga0213499_10062464	Ga0213499_100624642	F034461	MLGYDFEIVYKKGKKNVVADALSRKDEDFEVLLSTISIIHLDWITEERDEWKNDKDVWTLIQSVITQ
Ga0213499_10082061	Ga0213499_100820611	F011735	YIVKRVLGKGSYELEDYEGNILQRPRNGLYLKKYLPR
Ga0213499_10086994	Ga0213499_100869943	F011735	GPYVISKFLEKGTYELVNHDRTPLGEPRNGLYLKRYYD
Ga0213499_10094820	Ga0213499_100948202	F011735	MWHGPYIISKVLEKGAYELVNHDGTPLGEPRNGLYPKRYYA
Ga0213499_10095172	Ga0213499_100951721	F011735	MWHGPYIISKVLEKGAYELVNHNGTPLGEPRNGLYL
Ga0213499_10097214	Ga0213499_100972141	F034461	MLGYEFEIIYKKGKQNVMVDALSTKDEDVEALLCAIFIIQPDWIIEARDEW
Ga0213499_10099292	Ga0213499_100992921	F078199	QKWVICMLGHGFEVIYKKWKQNVVAEAPSRKDEDIGGLLCVISIP
Ga0213499_10100166	Ga0213499_101001661	F011735	MWIGPYIVSKVLKKGAYELMDYEGNKLSETRNGLYL
Ga0213499_10103329	Ga0213499_101033292	F011735	PYIVNKVLEKGAYELVNYDGISLGEPRNGLYLKRYYA
Ga0213499_10107806	Ga0213499_101078062	F011735	MWLGPYIVKKVLQKGAYELVDFEGIPLAEPINGFYLKKYYA
Ga0213499_10112377	Ga0213499_101123771	F011735	GKSESMWHGPYIVDKVLEKGAYQLVNYDGTLLGEPRNGLYLK
Ga0213499_10118340	Ga0213499_101183401	F011735	YIVGKVLEKAAYELINHDGTSLGEPRNGLYLKRYYA