3300019935: Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_1_MG

Overview

Basic Information

• IMG/M Taxon OID: 3300019935
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129088 | Gp0217616 | Ga0193950
• Sample Name: Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_1_MG
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 83300237
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities From Sediments And Microbial Mats In Various Locations
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater river biome → river → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1644
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012678	Metagenome / Metatranscriptome	278	Y
F012917	Metagenome / Metatranscriptome	276	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0193950_1005798	Not Available	1578
Ga0193950_1007676	All Organisms → cellular organisms → Bacteria	1344

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0193950_1005798	Ga0193950_10057981	F012678	MLNNHSLEEIATINNLLEDIKKEYYEGFQLTLRRMTPLRFKNPHTIPKI
Ga0193950_1007676	Ga0193950_10076761	F012917	ILFKFLRFPLKDSGYYNKYSSLLEIKEVWSQKKNLKRKRWSQN