3300019932: Arctic soil viral communities from Stordalen Mire, Sweden - P-A1

Overview

Basic Information

• IMG/M Taxon OID: 3300019932
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129143 | Gp0217706 | Ga0193764
• Sample Name: Arctic soil viral communities from Stordalen Mire, Sweden - P-A1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Restricted

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Dataset Contents

• Total Genome Size: 2380526
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Arctic Soil Viral Communities From Stordalen Mire, Sweden
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Arctic Soil → Arctic Soil Viral Communities From Stordalen Mire, Sweden

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → palsa → permafrost
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3526
  • Long. (^o): 19.0147
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011999	Metagenome / Metatranscriptome	284	Y
F019792	Metagenome / Metatranscriptome	227	Y
F086351	Metagenome / Metatranscriptome	111	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0193764_10020	Not Available	3486
Ga0193764_10169	Not Available	1451
Ga0193764_10318	All Organisms → Viruses → Predicted Viral	1056

Sequences

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold ID	Protein ID	Family	Sequence
Ga0193764_10020	Ga0193764_100205	F086351	MKLNSASKGHTPKGAHGRAAVRAIGRTKTTGNFAKIAAAKGKGAAIGAYQNKLKAHKSGNHEPHNAIGHHE
Ga0193764_10169	Ga0193764_101693	F019792	MDFDKIISNFKDYHLPICVVMFLVGSVMKWFGHLDMSYVAYTGTILGAITGHAFSPAQKDHDGPPQP
Ga0193764_10318	Ga0193764_103181	F011999	ICEISWLAQASTDSKQKGLFAVKAQEMKNSLDAAMQGIEGLINSDGSGMIDQIPATAVIVLAGGVPAAQTASITPVNVAVAFTDQQVVKFYSTAGVQRVGGATTATISYSDGPSNTLFFSTALPTDVVATDYIVVNGASYGSGNSILGIKAWDVNSNTGTIGGLNRNAYPGRLSTPTINLGGAAITPGIAQRAEVLLGRALGPDADSIKSGIWYGPPEQAFAQSNLMYNVQIANAQEIKGDKTLDMSKKYFSDTFGGRKYHKSWTATASRMDLLVMENWYIGELSPLELYDFGGGNVVAPVPDIGTVGGSYLTSHMFAYNTCFNLANAAPRAGLYVQNAAVPTV