NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300019825

3300019825: Microbial mat bacterial communities from Rhone River delta, Camargue, France - 5



Overview

Basic Information
IMG/M Taxon OID3300019825 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129318 | Gp0220900 | Ga0197836
Sample NameMicrobial mat bacterial communities from Rhone River delta, Camargue, France - 5
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Barcelona
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size56496487
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Mat Bacterial Communities From Rhone River Delta, Camargue, France
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mats → Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomedeltamicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationRhone delta, Camargue, France, EU
CoordinatesLat. (o)43.6Long. (o)4.6Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033261Metagenome / Metatranscriptome178Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0197836_1072438All Organisms → cellular organisms → Bacteria534Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0197836_1072438Ga0197836_10724381F033261DDRDIDARALLNEYGDHWGQEFAHRIGKHDLCLDILPPGYVLKTRRDEQGQLVREVEEDDTAFFLSAWLRCLVFNLMTRFAQAMGGKYTKMWAGTLLRKFIRRPATLYLIDKELHVVFDPFPDQDELQPLLDELNAKRTALPWLNNLVVQFRIADEEPLHPLPSLKKRNRLFGDG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.