NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300019374

3300019374: Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 3



Overview

Basic Information
IMG/M Taxon OID3300019374 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118397 | Gp0213381 | Ga0187897
Sample NameGoat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size306822252
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella copri2
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDetermining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)34.4148Long. (o)-119.8405Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041506Metagenome / Metatranscriptome160Y
F041521Metagenome159Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0187897_1014085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella copri2363Open in IMG/M
Ga0187897_1014253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella copri2338Open in IMG/M
Ga0187897_1101277Not Available548Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0187897_1014085Ga0187897_10140853F041506MSKTYTLEDGESLMAELKSTRGMMAEMRGRLERDEITPDEWREWYAGYQARLDEIKEAVSGMREDVSRRNADLERQKRERAAELNMSLEEYEIYLKSLIIS
Ga0187897_1014253Ga0187897_10142531F041506MNKIYTLDDNGEFMADLKAMHEEMLLMKRRLECDEITPDEWKQWHSGYRARLDEIKEAVSRMHDELSLRNADLERQKRERAAELNMSFDEYENYLKSLIIS
Ga0187897_1101277Ga0187897_11012771F041521GFLSFSNTNAQTTLENCLFAGKFEKGSNLTDEALLGAFGTLRSVNAIKNCYYLAHDGLAAVHSDSPLNANSDNVEITAVTEDDLRNNTIATQLGEYWTQGENYPVIKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.