3300019058: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001643 (ERX1782282-ERR1711961)

Overview

Basic Information

• IMG/M Taxon OID: 3300019058
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117946 | Gp0216903 | Ga0192997
• Sample Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001643 (ERX1782282-ERR1711961)
• Sequencing Status: Permanent Draft
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 885955
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): oceanic mesopelagic zone biome → marine mesopelagic zone → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: South Pacific Ocean: TARA_100
• Coordinates
  • Lat. (^o): -12.9794
  • Long. (^o): -96.0232
  • Alt. (m): N/A
  • Depth (m): 177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023858	Metatranscriptome	208	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0192997_10248	Not Available	647

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0192997_10248	Ga0192997_102481	F023858	EAHHLWDYGTDGQKLWTCPKGNPSCVAYYLKLNGPNCCKCDQDIGKPKPWDIPESGFLTKVNFVAYEDTTELYDHQVKGAEHWYESTGIPQVVSITYDYFLHREDSGDVVSHRIDFDTTVQQSGSILYGNFSVQHDIDAHRQKFAVPEVCKGNILNCCPDMDKIDAKWFKHDYALRQVKKKAEAAIAV