3300018547: Metatranscriptome of marine microbial communities from Baltic Sea - GS675_0p1

Overview

Basic Information

• IMG/M Taxon OID: 3300018547
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129055 | Gp0214159 | Ga0188831
• Sample Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS675_0p1
• Sequencing Status: Permanent Draft
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 2601378
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Metatranscriptome Of Marine Microbial Communities From Baltic Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Baltic Sea
• Coordinates
  • Lat. (^o): 62.09708
  • Long. (^o): 18.5427
  • Alt. (m): N/A
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008184	Metagenome / Metatranscriptome	337	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0188831_100520	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	621

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0188831_100520	Ga0188831_1005202	F008184	MAYTDLFNEAIDDLTASLTAVSGLRVVNDATKIVPNCVFIDAPSFTTMAGNGNVIRLEFPIRVIGSGPAGLP