NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018508

3300018508: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001642 (ERX1782381-ERR1712104)



Overview

Basic Information
IMG/M Taxon OID3300018508 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117946 | Gp0216902 | Ga0192994
Sample NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001642 (ERX1782381-ERR1712104)
Sequencing StatusPermanent Draft
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size519433
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Alternative Ecosystem Assignments
Environment Ontology (ENVO)oceanic mesopelagic zone biomemarine mesopelagic zonesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth Pacific Ocean: TARA_100
CoordinatesLat. (o)-12.9794Long. (o)-96.0232Alt. (m)N/ADepth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007563Metatranscriptome348Y
F013603Metatranscriptome269Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0192994_10181All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis552Open in IMG/M
Ga0192994_10200Not Available534Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0192994_10181Ga0192994_101811F007563CSANLPVPGSIPGLSIDQQYQYILQLQDHLNQQVQWNGRRKRSLPVPGTTGLVPGSAAEAQWYQQNLAQIALNNGRKKRSLPVPGTIPGLVPGSAAEAQWYQAQLAAIAGRKKRSLPVPGTTGLVPGSAAEAQWYQQNLAQIALNNGRKKRSLPVPGTTGLVPGSAAEAQWYQQNLAQIALNN
Ga0192994_10200Ga0192994_102001F013603SCEECNAAAAGLLARLTSPESIAEQTGILISQVCPQAADAAACEAGLSQWWGDMANCLFPAFIPGDHPCELLGLCKVKSVLGDWTCDDCTDIMTRVAAFMVKPETIEQGLAVLNGECFCGAEGHTAECPDLVASLAEPAMQVLSAVLMETTPELCQDIVGVC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.