NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017827

3300017827: Saline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P9



Overview

Basic Information
IMG/M Taxon OID3300017827 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129073 | Gp0214345 | Ga0189788
Sample NameSaline water viral communities from hypersaline pond near village of Ngallou, Senegal ? P9
Sequencing StatusPermanent Draft
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size1892334
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArchevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomepondhypersaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
Locationvillage of Ngallou, Senegal
CoordinatesLat. (o)14.0491Long. (o)-16.7624Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020468Metagenome / Metatranscriptome224Y
F057206Metagenome / Metatranscriptome136Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0189788_1145Not Available3695Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0189788_1145Ga0189788_11454F020468MPLVKKQITVADGATSDQILAGTTYEYVGPGTRLVVAAAADDAGVSMNFNVNNAEFARDAEVSEKVTGEPFGWKGGYVMNDMVTTAAERNRPIITFTNNSGASRTIDVAVFIGG
Ga0189788_1145Ga0189788_11456F057206MNYVIYVLCFFTIVNIFMCSIAIARVAEFKKSVAGLDWEAVATLLGDVATVKRSITRLNGRLNGMDNAQPNFDWKDQAAQVLNAPKQPATRGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.