3300017712: Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.S.N

Overview

Basic Information

• IMG/M Taxon OID: 3300017712
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110155 | Gp0206217 | Ga0181341
• Sample Name: Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.S.N
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 15244737
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: USA: Michigan
• Coordinates
  • Lat. (^o): 43.1881
  • Long. (^o): -86.344
  • Alt. (m): N/A
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000332	Metagenome / Metatranscriptome	1283	Y
F034461	Metagenome / Metatranscriptome	174	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0181341_104057	Not Available	638
Ga0181341_106029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	568

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0181341_104057	Ga0181341_1040571	F034461	MLGYDFEIIYKKGKQNIVAYALSQKDEKEEALWCALSILQENWVLEAKEEWKNDVATSNL
Ga0181341_106029	Ga0181341_1060292	F000332	VAKSGCRVREFYGIAYTVHDPTIRHREMMAWLDKNAPYCKSTEYMVIWNNLAEWAGTADSTWLRNKVVHGYKDALEREKK