3300017366: Metatranscriptome of marine eukaryotic communities from Narragansett Bay in marine media K with soil extract, 1:100 phosphorous, 18 C, 35 psu salinity and 409 ?mol photons light - Eutreptiella gymnastica CCMP 1594 (MMETSP0811_2)

Overview

Basic Information

• IMG/M Taxon OID: 3300017366
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212088 | Ga0186376
• Sample Name: Metatranscriptome of marine eukaryotic communities from Narragansett Bay in marine media K with soil extract, 1:100 phosphorous, 18 C, 35 psu salinity and 409 ?mol photons light - Eutreptiella gymnastica CCMP 1594 (MMETSP0811_2)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55158681
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis	1
All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA: Narragansett Bay
• Coordinates
  • Lat. (^o): 41.6
  • Long. (^o): -71.4
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004926	Metagenome / Metatranscriptome	418	Y
F035176	Metatranscriptome	172	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186376_1013501	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis	1197
Ga0186376_1027632	All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica	572

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186376_1013501	Ga0186376_10135011	F035176	IFFSSIHRDPHTMPVHSLAEDKPKILFYGAMMAIQNFGFFIMYFQIFPHITNTTECHTLRFWVGFFALDCFVESFCCLWMAMGGYIADTFWFGFGWILHLLVALPYCISTAGIPMAMYSAEGTTCRASMGTAGLTLEPVYWLHAAMFLVYVWMMLSITYYSFLKATFFGKQIGAVDEAPMCTSATPVRPV
Ga0186376_1027632	Ga0186376_10276321	F004926	GYRKNGTHNDNTVMVEALKLTTEQRDALLEYNHNQQQIEKLLCRFDSRNSQMTPWDSDWAGGTEGSDIRIAKEFALDVRKINAAKEVASEVFPLERAVTPFSEYKLRLGIGIMIEDGIKPKTPEAVRAWVNGGGKLKVGGDVLVGLKRWETLVPKTPDVDKLLSNMKEELETALAQKSKLIKPDDLPASF