NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017323

3300017323: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium, at 20 C, 35 psu salinity and 273 ?mol photons light - Eutreptiella gymnastica NIES-381 (MMETSP0039_2)



Overview

Basic Information
IMG/M Taxon OID3300017323 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211853 | Ga0186141
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in f/2 medium, at 20 C, 35 psu salinity and 273 ?mol photons light - Eutreptiella gymnastica NIES-381 (MMETSP0039_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size67192029
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022342Metagenome / Metatranscriptome214Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186141_1026121All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica727Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186141_1026121Ga0186141_10261211F022342FFRAASSAHKHTHTMPVRSLPEDKPKIVFHAVMMAIQNFGFFVMYYGLWGATPHPGLIGDVSGDPCSNTRFATGFMALTCFCEAFLCIGMAFGGYTDDKTVFTLYWFAHLVGGLCYIFCTGAVPAARFSDEGKACAKLSPSNGDRVQMVWIVHAVLFMVYVGGMLSITYFSFLKPTFFSKKVEDGPTTLTVQGENAVPPGDASKIE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.