3300017246: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 20 C, 21 psu salinity and 480 ?mol photons light - Coscinodiscus wailesii CCMP 2513 (MMETSP1066)

Overview

Basic Information

• IMG/M Taxon OID: 3300017246
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212239 | Ga0186527
• Sample Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 20 C, 21 psu salinity and 480 ?mol photons light - Coscinodiscus wailesii CCMP 2513 (MMETSP1066)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 39159288
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 31.4322
  • Long. (^o): -80.358
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067805	Metagenome / Metatranscriptome	125	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186527_122020	All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta	588

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186527_122020	Ga0186527_1220201	F067805	MGKKKAPKEEEITLSKKDAKKVAKLEAQIPYHEGRGSKDEVEKIKQQIEAIWEKTREAAF