NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017111

3300017111: Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 554 ?mol photons light - Emiliania huxleyi PLY M219 (MMETSP1153)



Overview

Basic Information
IMG/M Taxon OID3300017111 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211928 | Ga0186216
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 554 ?mol photons light - Emiliania huxleyi PLY M219 (MMETSP1153)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size35202652
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales1
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009840Metagenome / Metatranscriptome312Y
F013862Metagenome / Metatranscriptome267Y
F034449Metagenome / Metatranscriptome174N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186216_114406All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales927Open in IMG/M
Ga0186216_118631All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi745Open in IMG/M
Ga0186216_120026Not Available692Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186216_114406Ga0186216_1144061F013862AKAAPAAEEASSPSTLAAMASLDFWLMLLPKAMLFTYTQFFMNYIPQLLHASYGYDHGQAASLGGVAQGGSVIGLLVVGNMIYKGLAPGGKVKLVALLLAVCAAVPLALSLGPEVLPRPLVVPLAVLWGLAYALPFYIPPGEFAMQIGGKSATGLFSNLFDAAGFTFSALWNPWASSLAKDGDFRVVLLSQALFGALSLVAMPLCMHRQAARAASAKKVA
Ga0186216_118631Ga0186216_1186311F034449TLTPMTYMPTLKLAALALLASSTAALKVEKPVVKPVLKLRGGVSAGDVITGGALFLSASVGLPALAGGSDALFMINYPGFDWAGYQAKWTAESKSYLDTMTRFFGGALLLAGALQYYAKDVMAAKPYYAILTVTQLVFAGLQIFFAAPTAAMPSVHYVYAGMNAVLAVAGAMAMI
Ga0186216_120026Ga0186216_1200261F009840ASMRALSWLLLCSFRGTSALQPPRPGVSRRPLLQHALALGVLAPGAAAAAAEKKPSLKEVVAQLDAGTPKEERNAHGEKADHFPQIAFEGGQGQGKKVVFTVPHQNLSPPSFSYIEYMWIKDEESGAILTARKFRPSDPDLVITAFGSSGQRLTAASKDDKFGIWQGTFRVP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.