3300017094: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in marine media K with soil extract, 18 C, 35 psu salinity and 465 ?mol photons light - Ochromonas sp. CCMP1393 (MMETSP0004_2)

Overview

Basic Information

• IMG/M Taxon OID: 3300017094
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212222 | Ga0186510
• Sample Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in marine media K with soil extract, 18 C, 35 psu salinity and 465 ?mol photons light - Ochromonas sp. CCMP1393 (MMETSP0004_2)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 27931199
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 38.702
  • Long. (^o): -72.3667
  • Alt. (m): N/A
  • Depth (m): 22.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037232	Metagenome / Metatranscriptome	168	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186510_111951	Not Available	821

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186510_111951	Ga0186510_1119511	F037232	LSLTSSIQKPVLSSPNMPAFKIYDLVNTAYGTGYVTDIRSDCYVVLLTHWALAQGQSPTLFLQEEGMTLIPGALPGTTVKTPFGAARMEAVRNDDIHIAKPINWKLANDTIATMYLNPEAVELDCTAGFNEGDEVMTVYGRGYVEGKREETGDLVVKLRNWALAQGQSPTCYLDPATCVKIPGMEIGAAAKTVWGLMRLLEVRRDGTHVCEAMHWNLADGKPPRAYLAPEAFALLSIKPGSL