x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017052
3300017052: Metatranscriptome of marine eukaryotic communities from Ross Sea in PROV medium, 4 C, 32 psu salinity and 522 ?mol photons light - Ochromonas sp. CCMP1899 (MMETSP1177)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300017052 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211962 | Ga0186250 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Ross Sea in PROV medium, 4 C, 32 psu salinity and 522 ?mol photons light - Ochromonas sp. CCMP1899 (MMETSP1177) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 28787184 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | marine biome → marine water body → sea ice |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information |
| Location | Ross Sea |
| Coordinates | Lat. (o) | -77.8333 | Long. (o) | 163.0 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F037232 | Metagenome / Metatranscriptome | 168 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186250_111442 | Ga0186250_1114421 | F037232 | LDIMVASFGIHETVSTVYGPGYVAEVRKNDYVIKLANWALAQGQSPTLYLAADAIKSIPGAMVGTTVNTVYGPSNVQAIRGDGTHVARPLNWKLANNTVATLYLQSECIKLSQAAGFNEGDEVMTVFGRGFIESKRVKEGDLVIKLHYWALAQGQSPTLYMQSENVVKIHNLQIGSIAKTCWGLVRVLDILRNGQHVCEAVHWVMADGKNPTFYLAPEAFALMSLKP |
