3300017012: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 7 C, 32 psu salinity and 368 ?mol photons light - Asterionellopsis glacialis (MMETSP0713)

Overview

Basic Information

• IMG/M Taxon OID: 3300017012
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212250 | Ga0186538
• Sample Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 7 C, 32 psu salinity and 368 ?mol photons light - Asterionellopsis glacialis (MMETSP0713)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20737454
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis	1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → mesotrophic water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 41.325
  • Long. (^o): -70.5667
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068121	Metagenome / Metatranscriptome	125	Y
F098601	Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186538_106035	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis	1251
Ga0186538_107773	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	1036

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186538_106035	Ga0186538_1060351	F098601	MGGKKKQQQEEEITLSKKDLKKVTKLESQIPYHEGRGNKEEVVKIKQQIEDIWQKTKDAAYA
Ga0186538_107773	Ga0186538_1077731	F068121	MNFVRNFALFCLPISFASVEAFTIQSADFKVEQRIGLSREDHENRNQLNELPKGKIAPSPEDPTIWKDEKGRSWKLNAEPNAAYHQPMPLAVAFVRAYLGRVIPSLKVPNLKFISPNADGRYSEVCANRYTGELVIEQKIMGTYNFASDAPDAMKDGKLPTTGEHDTLDVVPHNEYGGNYRHIAQGMELGSISKGPIILGLLE