NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016962

3300016962: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 352 ?mol photons light - Emiliania huxleyi 374 (MMETSP1007)



Overview

Basic Information
IMG/M Taxon OID3300016962 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212257 | Ga0186545
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 352 ?mol photons light - Emiliania huxleyi 374 (MMETSP1007)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17114618
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia delicatissima1
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)42.5Long. (o)-69.0Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009840Metagenome / Metatranscriptome312Y
F015173Metatranscriptome256Y
F034449Metagenome / Metatranscriptome174N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186545_106877All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia delicatissima899Open in IMG/M
Ga0186545_109664All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi652Open in IMG/M
Ga0186545_110136Not Available618Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186545_106877Ga0186545_1068771F015173TGLCTRTPRSIVSMLNDTAAFNSTGVAEDQVTLVGLFNQLLALLFPIWPWEPFIVMPFALEILRAKRKTGLSVGFVTIFAAVFCLAHGVGFVQAIDTVFYGGSGICACALPGAPDDIDTKAMCNMMAIHIFLMLLMGVFFARIALSPSRRVPVGGLEAVYCSRAALFFVVGGVSQGIPYWAVTFQYPERFEEFMRADGFYSARGITPGAVEFVSPLVWIVYGLYSYGELMSLVDSAGNTANDKASVGGALPPMV
Ga0186545_109664Ga0186545_1096641F034449TYMPTLKLAALALLASSTAALKVEKPVVKPVLKLRGGVSAGDVITGGALFLSASVGLPALAGGSDALFMINYPGFDWAGYQAKWTAESKSYLDTMTRFFGGALLLAGALQYYAKDVMAAKPYYAILTVTQLVFAGLQIFFAAPTAAMPSVHYVYAGMNAVLAVAGAMAMI
Ga0186545_110136Ga0186545_1101361F009840SMRALSWLLLCSFRGTSALQPSKPGVSRRPLLQHALALGVLAPGAAAAAAEKKPSLKEVVAQLDAGTPKEERNAHGEKADHFPQIAFEGGQGQGKKVVFTVPHQNLSPPSFSYIEYMWIKDEESGAILTARKFRPSDPDLVITAFGSSGQRLTAASKDDKFGIWQGTFRVP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.