3300016958: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 142 ?mol photons light - Emiliania huxleyi 374 (MMETSP1006)

Overview

Basic Information

• IMG/M Taxon OID: 3300016958
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212259 | Ga0186547
• Sample Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 142 ?mol photons light - Emiliania huxleyi 374 (MMETSP1006)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 17188796
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 42.5
  • Long. (^o): -69.0
  • Alt. (m): N/A
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009840	Metagenome / Metatranscriptome	312	Y
F034449	Metagenome / Metatranscriptome	174	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186547_108838	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi	723
Ga0186547_109598	Not Available	669

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186547_108838	Ga0186547_1088381	F034449	ENTYMPTLKLAALALLASSTAALKVEKPVVKPVLKLRGGVSAGDVITGGALFLSASVGLPALAGGSDALFMINYPGFDWAGYQAKWTAESKSYLDTMTRFFGGALLLAGALQYYAKDVMAAKPYYAILTVTQLVFAGLQIFFAAPTAAMPSVHYVYAGMNAVLAVAGAMAMI
Ga0186547_109598	Ga0186547_1095981	F009840	FRGTSALQPSRPGVSRRPLLQHALALGVLAPGAAAAAAEKKPSLKEVVAQLDAGTPKEERNAHGEKADHFPQIAFEGGQGQGKKVVFTVPHQNLSPPSFSYIEYMWIKDEESGAILTARKFRPSDPDLVITAFGSSGQRLTAASKDDKFGIWQGTFRVP