x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016956
3300016956: Metatranscriptome of freshwater eukaryotic communities from California, USA in COMBO medium, 20 C, 21 psu salinity and 655 ?mol photons light - Thalassiosira sp. FW (MMETSP1059)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016956 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212364 | Ga0186652 |
| Sample Name | Metatranscriptome of freshwater eukaryotic communities from California, USA in COMBO medium, 20 C, 21 psu salinity and 655 ?mol photons light - Thalassiosira sp. FW (MMETSP1059) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 25812950 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 2 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information |
| Location | California, USA |
| Coordinates | Lat. (o) | 34.27944 | Long. (o) | -114.22222 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F099352 | Metatranscriptome | 103 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186652_108311 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 1142 | Open in IMG/M |
| Ga0186652_111071 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 651 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186652_108311 | Ga0186652_1083111 | F099352 | MVFNGAEAFKGEGPALERELSVTSTSNRVLLDSKELNAASGAFNVCCAEAYAKFADLKRQRIHPGKMTKERDAVESCSADVYKGIQSLCSDQLDAVKACLSDNPDSWAKCAAARRDLDVCSVRNGLGEIKK |
| Ga0186652_111071 | Ga0186652_1110711 | F099352 | SNVNETNTTPPPLLNRQRRFLNINTMVFNGAEAFKGEGPALERELSVTSTSNRVLLDSKELNAASGAFNVCCAEAYAKFADLKRQRIHPGKMTKERDAVESCSADVYKGIQSLCSDQLDAVKACLSDNPDSWAKCAAARRDLDVCSVRNGLGEIKK |