x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016945
3300016945: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with Sargasso seawater w/o silicate, 14 C, 36 psu salinity and 414 ?mol photons light - Skeletonema marinoi skelA (MMETSP0920)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016945 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212288 | Ga0186576 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with Sargasso seawater w/o silicate, 14 C, 36 psu salinity and 414 ?mol photons light - Skeletonema marinoi skelA (MMETSP0920) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 21304266 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | marine biome → estuary → estuarine water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information |
| Location | Atlantic Ocean |
| Coordinates | Lat. (o) | 41.573611 | Long. (o) | -71.408611 | Alt. (m) | N/A | Depth (m) | .5 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F034938 | Metagenome / Metatranscriptome | 173 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186576_104759 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema | 1359 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186576_104759 | Ga0186576_1047591 | F034938 | DSHIPFPSFTTPTNSNITMMNAAFPNAQRMHYEGAASSSTGHRTMTNEAIILPKISADDQVAQRDDEESNANATNMVLWRGNLVAEKEAMALRHVFDDMQDHFGHQRADPRVRFNANLVRPSRDGMWFGDLDFTYNINGEHCNLGYIGMDVCVDLCPKLVHKHGQLRLKNYGKSWVYVYLPQLTLDKFKSYVKTGTGWDVTNEGTVYDPNRNLVAIEAMLHHQPGQPKPSFWAVKDKDASGGDNMSFSRIGTVQEVNEHPHQQRVHRGVGIFSVSMEVEGSPNFKPTPRAGDEANLCFTLVSVRTWGVTDCVAPIVHAPNKWY |