NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016940

3300016940: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in marine media K with soil extract, 18 C, 35 psu salinity and 456 ?mol photons light - Ochromonas sp. CCMP1393 (MMETSP0005)



Overview

Basic Information
IMG/M Taxon OID3300016940 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212223 | Ga0186511
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in marine media K with soil extract, 18 C, 35 psu salinity and 456 ?mol photons light - Ochromonas sp. CCMP1393 (MMETSP0005)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size27601353
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)38.702Long. (o)-72.3667Alt. (m)N/ADepth (m)22.5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037232Metagenome / Metatranscriptome168Y
F054104Metagenome / Metatranscriptome140Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186511_111835Not Available821Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186511_111835Ga0186511_1118351F037232NLSLTSSIQKPVLSSPNMPAFKIYDLVNTAYGTGYVTDIRSDCYVVLLTHWALAQGQSPTLFLQEEGMTLIPGALPGTTVKTPFGAARMEAVRNDDIHIAKPINWKLANDTIATMYLNPEAVELDCTAGFNEGDEVMTVYGRGYVEGKREETGDLVVKLRNWALAQGQSPTCYLDPATCVKIPGMEIGAAAKTVWGLMRLLEVRRDGTHVCEAMHWNLADGKPPRAYLAPEAFALLSIKPGSL
Ga0186511_112196Ga0186511_1121961F054104EIVNSKYNTVKKGLLETFETTENLITNFENKAFVSLQRYIILVTASKILRKFFGLSEKEQSKLIELTISKLGGDN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.