x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016874
3300016874: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in enriched f/2 medium with seawater, 10.6uM sodium metasilicate, 16 C, 35 psu salinity and 441 ?mol photons light - Pseudo-nitzschia fraudulenta WWA7 (MMETSP0853)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016874 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212036 | Ga0186324 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in enriched f/2 medium with seawater, 10.6uM sodium metasilicate, 16 C, 35 psu salinity and 441 ?mol photons light - Pseudo-nitzschia fraudulenta WWA7 (MMETSP0853) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 22748722 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | marine biome → cove → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information |
| Location | Pacific Ocean |
| Coordinates | Lat. (o) | 34.0847 | Long. (o) | -119.05 | Alt. (m) | N/A | Depth (m) | 1 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F015298 | Metagenome / Metatranscriptome | 255 | Y |
| F056296 | Metagenome / Metatranscriptome | 137 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186324_100138 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae | 4259 | Open in IMG/M |
| Ga0186324_108609 | All Organisms → cellular organisms → Eukaryota | 1101 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186324_100138 | Ga0186324_1001381 | F015298 | MTIGMLNSLVPHKDKLLLFCISVDAVNTIITFPMIMWNGPKWLLQSTDPNAKEKIEDADEGKEVVDLSDTDRRSFKVLWEIFGVCYEGYFGFTISTLICLFQSPETRPIFAYSLFALYVYKAKSFLTTFKTDNTQGKAKLLTILCFYFPCYGGYCLLHLAENYLL |
| Ga0186324_108609 | Ga0186324_1086091 | F056296 | NNTFFVESKKTTTTMKSIVAVLISLLAVSNAVELTLENFEEKTAGKTVFIKFLAPW |