NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016788

3300016788: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, no silica, at 16 C, 34 psu salinity and 611 ?mol photons light - Isochrysis sp. CCMP 1324 (MMETSP1130)



Overview

Basic Information
IMG/M Taxon OID3300016788 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211862 | Ga0186150
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, no silica, at 16 C, 34 psu salinity and 611 ?mol photons light - Isochrysis sp. CCMP 1324 (MMETSP1130)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10260723
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Discoba → Heterolobosea → Tetramitia → Eutetramitia → Vahlkampfiidae → Naegleria → Naegleria gruberi1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024700Metagenome / Metatranscriptome204Y
F098706Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186150_103596All Organisms → cellular organisms → Eukaryota904Open in IMG/M
Ga0186150_105664All Organisms → cellular organisms → Eukaryota → Discoba → Heterolobosea → Tetramitia → Eutetramitia → Vahlkampfiidae → Naegleria → Naegleria gruberi649Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186150_103596Ga0186150_1035961F098706SRSLAMLSVSFFALAANRAEVSTGNLRGENKFDNLKATWDKSVSIGDFKTLVKAKYDYNANRDFLKEVSISGDLIEAGNADDVGVGYELTRDFSNRNTNVRLTATSRGYSLSAEYDPNEQLREVGVSREVEVGDYKVDVQPTWLVKAKAARVKLISALNNGKDRVSAQFDYDVDGQQAKDVELGFERTLEEGKVLSASFRPDKSDLEVSLEDSTFESGATWTATANVALDSDPSNLLDAARVTLKRSWGW
Ga0186150_105664Ga0186150_1056641F024700PRRPVAAHGRVGLMAASVTGLRAPSAKGRRQGPYAGMDLSAVVSTLESHWVVLEAELAEIKKDYVTMRSFTRKYGEYWSRSLATLRKLRVEKENLLKEIKFQMELFNLHIQQGRDLCYKLSQMASTIKTQPQHSTQQLSIEVVSPILANAQNPLAVSRHPND

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.