3300016775: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in f/2 medium with artificial seawater, no silicate, 21 C, 35 psu salinity and 458 ?mol photons light - micromonas sp. RCC472 (MMETSP1387)

Overview

Basic Information

• IMG/M Taxon OID: 3300016775
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212072 | Ga0186360
• Sample Name: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in f/2 medium with artificial seawater, no silicate, 21 C, 35 psu salinity and 458 ?mol photons light - micromonas sp. RCC472 (MMETSP1387)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 19632387
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: North Pacific Ocean
• Coordinates
  • Lat. (^o): 8.5
  • Long. (^o): -78.22
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062730	Metagenome / Metatranscriptome	130	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186360_100412	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	5040

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186360_100412	Ga0186360_1004123	F062730	MGTETPIGYRLVRVGVRGRVPTLHSRAPEDLTTRQKYDLRYREKHRAKLLALNLL