3300015049: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_S2_MetaG

Overview

Basic Information

• IMG/M Taxon OID: 3300015049
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127568 | Gp0198142 | Ga0180012
• Sample Name: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_S2_MetaG
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 110630564
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → planetary subsurface zone → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Finland: the Olkiluoto Island
• Coordinates
  • Lat. (^o): 61.2413
  • Long. (^o): 21.4947
  • Alt. (m): N/A
  • Depth (m): 420

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104432	Metagenome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0180012_1000208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	24761

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0180012_1000208	Ga0180012_100020814	F104432	MTFDAGTLVTLGLAGVAVIVWLVRLEGRVNNKASSEIVSALTAVVTALQAKEAGHDQTRDEVIRLQEQIKHLTNLIERLLPASRRKVSE*