3300014943: Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10027

Overview

Basic Information

• IMG/M Taxon OID: 3300014943
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121306 | Gp0151735 | Ga0134563
• Sample Name: Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10027
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Bologna
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 73917178
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Tanzania
• Coordinates
  • Lat. (^o): -3.6347588
  • Long. (^o): 35.0828588
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134563_108429	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1423

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134563_108429	Ga0134563_1084292	F029444	MGVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEISGIIAEKESQIFGRRFVGFDS*