| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014938 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151616 | Ga0134444 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS68_3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 79538473 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061388 | Metagenome | 132 | N |
| F090513 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134444_100054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 137189 | Open in IMG/M |
| Ga0134444_101927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 4139 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134444_100054 | Ga0134444_10005471 | F061388 | MPEGGADMGGRGGSSHRQTAGGTAAIQTFLQNAYGANHANAVLAILQNAPAHIRALWEQYAVQFRATNMRRDEGAFYSPRDDSVHLHIPSVARGDAISTPYSVLFHEYGHMTDYLIARTHNQGNYSAYSDLFQGIGSDGKAIIRSGSSGGLLGRTAKDELEGHLARMRRQNPNLNRQQAARALVSEANSKYSYRDRSDISDMFEGAGLGIAHPLGAGHGLDYWISRGNSREIFAEIISAEAAHPGSLKAIKEYFPRTYQVYQDMMKARKKR* |
| Ga0134444_101927 | Ga0134444_1019274 | F090513 | MAKYVRKMEWKLLHIKHILYMQPFGALKIAPQSVGNKNGTKAVLQGWAAAFVPYM |
| ⦗Top⦘ |