| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014792 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151599 | Ga0134427 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS63_24 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 133304745 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052660 | Metagenome | 142 | N |
| F064817 | Metagenome | 128 | N |
| F077781 | Metagenome / Metatranscriptome | 117 | N |
| F090513 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134427_1000062 | Not Available | 85758 | Open in IMG/M |
| Ga0134427_1004990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 4119 | Open in IMG/M |
| Ga0134427_1031586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 696 | Open in IMG/M |
| Ga0134427_1042994 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan | 506 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134427_1000062 | Ga0134427_1000062100 | F064817 | MNIKNLFNRFRKREPELSYSLNLIYLEDTKVVFNQNIQGAKDLENYLSAYMRLFGMYSDKPYVLIYQEYKSRYWVYDKEPYLLYYKVPLLVNLSRKLSGKSDMVITKEKYQAAKDLVPAHEVSDRFKIPDYITGVFTDIWYKCQGYMDTDHVDLEEILELMHYNWLKEFELLVFKRNYDTDMLFLNHSLTYILDQTEEDDQRICIQNIIERNINQENQDENETI* |
| Ga0134427_1004990 | Ga0134427_10049904 | F090513 | MAKYVRKMEWKLLHIKHILYRQPFGALKIAPQSVGNKNGTKAVLQGWAAAFVPYML |
| Ga0134427_1031586 | Ga0134427_10315861 | F052660 | HVLPENTPERIGQERAGTEWTVVKSKIRLCIRNRSYGRFFYGGILMGIALPIPAHRAKSHDFACWWPAAADHSRSADALPGKSNF* |
| Ga0134427_1042994 | Ga0134427_10429941 | F077781 | FILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT* |
| ⦗Top⦘ |