3300014779: Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg4

Overview

Basic Information

• IMG/M Taxon OID: 3300014779
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0127414 | Gp0192469 | Ga0169465
• Sample Name: Synthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg4
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Liverpool
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 95897884
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom
• Type: Engineered
• Taxonomy: Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Synthetic → Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): na → na → na

Location Information

• Location: United Kingdom: Liverpool
• Coordinates
  • Lat. (^o): 53.405936
  • Long. (^o): -2.9677609
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0169465_1024976	All Organisms → cellular organisms → Bacteria	944

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169465_1024976	Ga0169465_10249762	F010244	MFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*