3300014761: Human fecal microbial communities from obese patients in Germany - AS60_3

Overview

Basic Information

• IMG/M Taxon OID: 3300014761
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121297 | Gp0151610 | Ga0134438
• Sample Name: Human fecal microbial communities from obese patients in Germany - AS60_3
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hohenheim
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 93579410
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Obese Patients In Germany
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Germany
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039198	Metagenome	164	Y
F099269	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134438_102485	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	5088
Ga0134438_105666	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens	2293

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134438_102485	Ga0134438_1024854	F039198	MQITSCEIANSKYIQIYLTEEELEKQETKEFINKYKKEKYSVAIFVTGKENYPEVLKKIVVKQEELNKNVC*
Ga0134438_105666	Ga0134438_1056662	F099269	VGELLLLDDLGDRAGGASVLASATGDAGILVSDGGDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCASV*