3300014709: Human fecal microbial communities from obese patients in Germany - AS60_24

Overview

Basic Information

• IMG/M Taxon OID: 3300014709
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121297 | Gp0151596 | Ga0134424
• Sample Name: Human fecal microbial communities from obese patients in Germany - AS60_24
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hohenheim
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 64998144
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Obese Patients In Germany
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Germany
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N
F073656	Metagenome	120	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0134424_100105	Not Available	44031
Ga0134424_101433	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes	7277

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134424_100105	Ga0134424_10010522	F055775	MAQIAQQDNLVIEVSTTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIVIINANSGAVAAIALN*
Ga0134424_101433	Ga0134424_1014332	F073656	MTMEQDQEQMQGALYVAVDDGNKIIAMERSRRGDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHXXXXNYLLDPSTVTEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGAVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFVDPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIHTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGAEFHLKRH*