Basic Information | |
---|---|
IMG/M Taxon OID | 3300014573 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151595 | Ga0134423 |
Sample Name | Human fecal microbial communities from obese patients in Germany - AS58_24 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hohenheim |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 111820318 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Obese Patients In Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026489 | Metagenome | 197 | N |
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F055775 | Metagenome | 138 | N |
F078693 | Metagenome | 116 | N |
F101357 | Metagenome / Metatranscriptome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134423_1000085 | Not Available | 85831 | Open in IMG/M |
Ga0134423_1000233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 44977 | Open in IMG/M |
Ga0134423_1000739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae | 17809 | Open in IMG/M |
Ga0134423_1000843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 15778 | Open in IMG/M |
Ga0134423_1009020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1460 | Open in IMG/M |
Ga0134423_1034937 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134423_1000085 | Ga0134423_100008593 | F101357 | MNLNNITTALKTGITIYQYEQWQNTGSVNLMQKESHMLSKVWLKTNIHNPDSLDKPFIQLSATFTSEFDIQEYNEWLNANQYKLYPLLLDILKISLKDNFYNYSNASNIHHEGGKFPSMLTIQLFNLEF* |
Ga0134423_1000233 | Ga0134423_100023328 | F026489 | LTPKENQKSASDFDALEPRKXXXXPEKTEDSRLFGVKIF* |
Ga0134423_1000739 | Ga0134423_100073910 | F055775 | MAQIAQQDNLVIEVTTTAKALDSDTKKKLIECIKGGTITDVILVTKEVDKKISHARVVSWLVDTAGSSPKYTIDIINANSGAVEEIALN* |
Ga0134423_1000843 | Ga0134423_10008433 | F078693 | MVLAPVRGAERSCIKANYSLLMSKENQKTTSDFDALDPRERGCSPLSDPEGVVEXXXXFFGIVKGE* |
Ga0134423_1009020 | Ga0134423_10090203 | F026592 | CQNRLRTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADWE* |
Ga0134423_1034937 | Ga0134423_10349371 | F026592 | PQGIAALAAQGGVATLTERSDETFSVMQFLSADRE* |
⦗Top⦘ |