| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014573 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151595 | Ga0134423 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS58_24 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 111820318 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F055775 | Metagenome | 138 | N |
| F078693 | Metagenome | 116 | N |
| F101357 | Metagenome / Metatranscriptome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134423_1000085 | Not Available | 85831 | Open in IMG/M |
| Ga0134423_1000233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 44977 | Open in IMG/M |
| Ga0134423_1000739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae | 17809 | Open in IMG/M |
| Ga0134423_1000843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 15778 | Open in IMG/M |
| Ga0134423_1009020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1460 | Open in IMG/M |
| Ga0134423_1034937 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134423_1000085 | Ga0134423_100008593 | F101357 | MNLNNITTALKTGITIYQYEQWQNTGSVNLMQKESHMLSKVWLKTNIHNPDSLDKPFIQLSATFTSEFDIQEYNEWLNANQYKLYPLLLDILKISLKDNFYNYSNASNIHHEGGKFPSMLTIQLFNLEF* |
| Ga0134423_1000233 | Ga0134423_100023328 | F026489 | LTPKENQKSASDFDALEPRKXXXXPEKTEDSRLFGVKIF* |
| Ga0134423_1000739 | Ga0134423_100073910 | F055775 | MAQIAQQDNLVIEVTTTAKALDSDTKKKLIECIKGGTITDVILVTKEVDKKISHARVVSWLVDTAGSSPKYTIDIINANSGAVEEIALN* |
| Ga0134423_1000843 | Ga0134423_10008433 | F078693 | MVLAPVRGAERSCIKANYSLLMSKENQKTTSDFDALDPRERGCSPLSDPEGVVEXXXXFFGIVKGE* |
| Ga0134423_1009020 | Ga0134423_10090203 | F026592 | CQNRLRTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADWE* |
| Ga0134423_1034937 | Ga0134423_10349371 | F026592 | PQGIAALAAQGGVATLTERSDETFSVMQFLSADRE* |
| ⦗Top⦘ |